PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009767946.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 577aa    MW: 65490.7 Da    PI: 7.7965
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009767946.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK44.82.4e-14520563346
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPh 46 
                     ++i+l++++   s++  +AA  Lgv+ ++LKriCR yGI RWP 
  XP_009767946.1 520 HNINLKKIEDRSSMTQDAAADGLGVGKSTLKRICRLYGITRWPP 563
                     79*****************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151912.707506577IPR003035RWP-RK domain
PfamPF020421.0E-11521564IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 577 aa     Download sequence    Send to blast
MECVFSEQAW SRQPNGLWVF WSERDDAEQL QNHFSFTADV VTKRMAIKER VKIALQHVEK  60
LSCNYLIQYW ASIVIDAQTF LTTSDQPFGL TRLEYGLCSY RKKCLSHAIP VELKNGTQCE  120
NDLGPPGRVF KHRLPELCTN MKNYSKQEFP LRDDAVAWSI QWCYTVPVFD PSRDTFVGVL  180
ELVTIHQTKE WICGNSVLPI FKMLQVLDDR QCALGGLYKA IEVVCQKHQF LFAQIWVSVA  240
DSWCTGKVIT VRQRHIAIND NQNLNLFKYA SGLQYILEGY GVVGRAFSSK SSCFCRDVTR  300
LSIMEYPLVT CAREAGLTGC FAICLSAPGN DDNVFILEFF LPPNELLRRN LQDFLKLVLG  360
TVKQQLQHVK VAVGHDFGEM LPVEVIKISS DDELDSFDIC QTTKELQNAE PLPNGGELML  420
LDTPNQQSFS SETNQQLSLD IDEINAERDS IAVSEEQCNS AGSSTSAKTS QNKERKLQLD  480
LSTRQAKQGA NAGNKRKKGK RIFTSESEIQ KERERIEQDH NINLKKIEDR SSMTQDAAAD  540
GLGVGKSTLK RICRLYGITR WPPKNKEKKR KCSHSRK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1562570PKNKEKKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767946.10.0PREDICTED: protein NLP3-like isoform X3
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.14e-54Nin-like family protein